PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_013864-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 315aa    MW: 33692.8 Da    PI: 8.4918
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_013864-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-14112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
    NNU_013864-RA 112 PWTEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.04898161IPR017930Myb domain
SMARTSM007172.9E-10109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-12111155IPR009057Homeodomain-like
SuperFamilySSF466891.87E-16111162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17111160IPR006447Myb domain, plants
PfamPF002499.4E-12112156IPR001005SANT/Myb domain
CDDcd001679.33E-10112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRKCSHCGN MGHNSRTCTN YRASAVGGGL KLFGVQLDLS SSSSLALKKS FSMDCLPSTS  60
SASSSSSSSL SSSSRVVADE NSDKISNGYL SDGLIGRTQE RKKAVCGWLG VPWTEEEHRT  120
FLAGLEKLGK GDWRGISRNF VTTRTPTQVA SHAQKYFLRQ ANLNKKKRRS SLFDMVGSSN  180
VTDQHVNSTS FKSRDPSVAC GLLPVLSPAL NIATASYSEV HHQDATLPLL DLNALEQRTE  240
VGGEDTNFFK LPSCFHLTPV GPNESLDSEP RAATVTNAGV QNASPDLELT LAVQSPMDQS  300
KSSPAPILIG PISVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164168KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266999.10.0PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLD7TB951e-105D7TB95_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g02410.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-54MYB_related family protein